SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22037724m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22037724m.p
Domain Number 1 Region: 107-164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.4e-22
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 163-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 69-121
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-17
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 4 Region: 209-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22037724m.p
Sequence length 289
Sequence
MKPSARQMLFTSHRHKYQICDTNIGHVASMRPNTVIWFLTCMNTNVFNVVSTSNVCDLPQ
ILQPPARERPYHCITCGKSFSTSSTLTTHKRIHTGERPYHCVTCGKSFSINSGLTQHKRT
HTGEKPHHCITCGKSFSKISGLTQHKRTHTGEKPYHCDICDKTFTENRNLRRHKRIHTGE
KPFPCVTCGKSFSSSSGLTNHKRIHTGVKPFHCVVCDKSFSRKITLTTHKCIHTREKPYT
CDICGKAFSDSFVFREHRRIHSGERPSKTFVLQAIHTNSPGIIYKLTRL
Download sequence
Identical sequences A0A0L8GAF9
Ocbimv22037724m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]