SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Ocbimv22038518m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22038518m.p
Domain Number 1 Region: 333-603
Classification Level Classification E-value
Superfamily Kelch motif 1.31e-62
Family Kelch motif 0.00027
Further Details:      
 
Domain Number 2 Region: 57-175
Classification Level Classification E-value
Superfamily POZ domain 1.41e-30
Family BTB/POZ domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22038518m.p
Sequence length 612
Sequence
MPTLKHGPGYTPFLRRRSYPSERSKHTTSTTKTTTATVMAEQNKDVEEDSYSQGMFYFSS
QHSDALRANVEAFRVNANYTDVTIIIEDKKFPCHRAILAAGSYYFKSMFSSGMEETHKNS
FTIKQIDPLVFGHVLHFIYTGSITITTGIVFELFSQSHMFQISTLVELCVQFFKEEISDS
NCLCALSLSDAHAHKELYEFTKEYACKHFTSLIKDEDFLRLSGECVIDLLNDRRLNCTTE
SQVFEAAVKWLEYDIEHRKSFRYQMMTCVKFPLIAQSYLLDYVIKSNHMTCEKGQEMIED
AISFHTVPSRRNLLQAYQITPRFAFSYTEVAVLLGGRVADGLSSDVEFYRPDTKEFVSLK
PLPFKKRNEYAAAVIGNEIYVSGGLRSPELWKYDLTFHSWIRGNNMLQARRRHAMAVVDN
NIYVLGGFDEECVLNTVEMWDSSSNKWTSTGKLLFAVENMGYVAYGKYIYLFGGKNNDEV
VTNVVQCYDTTTHTCSIVKNGLPANDMCLSAVVLNSQIYVVGLEGVFRYTPLTGNWDILP
EMRCARDFVSLAVLDEKIYLFGGRCRGSKENLYSDLIEVYNSKDNSWDVVGKIPVPMYSY
GCVKIFLSQTNT
Download sequence
Identical sequences A0A0L8G7L6
Ocbimv22038518m.p XP_014783348.1.24776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]