SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15613861|ref|NP_242164.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15613861|ref|NP_242164.1|
Domain Number 1 Region: 30-137
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000000131
Family Collagen-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15613861|ref|NP_242164.1|
Sequence length 277
Comment hypothetical protein BH1298 [Bacillus halodurans C-125]
Sequence
MVKNMVLSLLLLLFLVPANLVHAESEPRIIDQYEENNTFNTAYPLGNWKYKLLSGTIHAP
EDYDYYQFTASKGDRLAIRLSQIPNHVNYDLYLYKDSYGYPLIDYSTRSGNQDEIIRFDV
PETGSYIVLVRSADGSYDDWNFYRLTFIDRIKTATYTANLTPTVLTSPGAGTTSQVASVN
LSNQQAVPDGAIVRSVSAQGTISPSLGHTYREVMNGSEGIWYTSISGSGSFPDITVAKEL
PVKTIWHVRYYSLAHSSSTWRNPQIRITYEYDETYHY
Download sequence
Identical sequences Q9KDB5
272558.BH1298 gi|15613861|ref|NP_242164.1| WP_010897466.1.28103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]