SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27375493|ref|NP_767022.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27375493|ref|NP_767022.1|
Domain Number 1 Region: 94-223
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.1e-25
Family GntR ligand-binding domain-like 0.014
Further Details:      
 
Domain Number 2 Region: 19-88
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.49e-18
Family GntR-like transcriptional regulators 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|27375493|ref|NP_767022.1|
Sequence length 236
Comment transcriptional regulator [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MEVTHTAPRAARPARLDRARQAAPQVFERLRNAIIALELPPGAPLSRAELAGQFGVSSTP
VRDALMRLEEEGLVDVFPQHATVVSRIDIGRAQQAHFLRQALELEIVRLLAEKHDDALII
RLDHAIALQQQFAKAGEFEAFMAADNDFHAQLYAAAGKQELWALVRSRSGHIDRLRRLHL
PSPGKAQNIVRHHRLITRAIEAGDADAAQQHLRKHLSGTLSELDKIRSHHPEYLTD
Download sequence
Identical sequences A0A2A6N0T6 Q89XD2
224911.blr0382 gi|27375493|ref|NP_767022.1| NP_767022.1.11505 WP_011083214.1.15658 WP_011083214.1.90507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]