SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27376390|ref|NP_767919.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27376390|ref|NP_767919.1|
Domain Number 1 Region: 86-223
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.28e-26
Family GntR ligand-binding domain-like 0.013
Further Details:      
 
Domain Number 2 Region: 18-84
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.72e-18
Family GntR-like transcriptional regulators 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|27376390|ref|NP_767919.1|
Sequence length 239
Comment transcriptional regulator [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MAGLLKVAADAEDDGGLLSDRIRNALTDEIASGALVAGSALEEQLLADRFGASRTPVREA
LRQLVVSGLVEVRGRRGLVVARMTPERIMDMFETSAEVEAMCVRLATYRMTPLERSHLIE
LHDASLKMVEANDVDTYDAFNREFHECIYRATHNSFLAEQAQDVRSRLSAFRRTQLRHGD
RIRKSRDEHDVIMQAIAEGDGETASRRMRAHMLNAAAALRRYIDDRLGGQADGPGPDNA
Download sequence
Identical sequences A0A2A6MY65 Q89UY0
NP_767919.1.11505 WP_011084097.1.15658 WP_011084097.1.90507 224911.blr1279 gi|27376390|ref|NP_767919.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]