SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27377205|ref|NP_768734.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27377205|ref|NP_768734.1|
Domain Number 1 Region: 78-206
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.6e-21
Family GntR ligand-binding domain-like 0.019
Further Details:      
 
Domain Number 2 Region: 5-75
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.07e-17
Family GntR-like transcriptional regulators 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|27377205|ref|NP_768734.1|
Sequence length 211
Comment transcriptional regulator [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MITADNMTMVARIADSIAERIISGALAPGAPLRQDHVAREFNSSHVPVREAFRHLQAQHL
VVAVPRRGVRVAPLDTRSVKEIAEMRAALEVVALRHSGPRLTTAHLAQIELALIEGDNAK
TIEEFEMANRAFHQALVAPCGMPRLLASLDGLQLANSRLVFAMARSVGWRPRSNQDHRLI
LQALRTRNVDHACNLLTRHIQTIERLALPAS
Download sequence
Identical sequences A0A023X9I4 A0A270RTP7 A0A2A6MN70 H7C6R6 Q9AMS8
224911.bll2094 NP_768734.1.11505 WP_011084889.1.15658 WP_011084889.1.18950 WP_011084889.1.24896 WP_011084889.1.35620 WP_011084889.1.43076 WP_011084889.1.52884 WP_011084889.1.62155 WP_011084889.1.62673 WP_011084889.1.64673 WP_011084889.1.67778 WP_011084889.1.67973 WP_011084889.1.6944 WP_011084889.1.77977 WP_011084889.1.81322 WP_011084889.1.85912 WP_011084889.1.8978 WP_011084889.1.90507 WP_011084889.1.91491 WP_011084889.1.97209 gi|27377205|ref|NP_768734.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]