SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27377715|ref|NP_769244.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27377715|ref|NP_769244.1|
Domain Number 1 Region: 35-172
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.64e-39
Family HxlR-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|27377715|ref|NP_769244.1|
Sequence length 182
Comment transcriptional regulator [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MLASRANCTDHSSQFLFLTYYACVGDRIMKWDTLDEESCSLSRTVAVVGDRWTLLILREC
FLRVRRFEGFQSSLQITRHLLSERLKKLVRFGILRRVPYSEAPKRYEYILTQKGLDLYPI
IMAMVHWGDTHMGDERGRPMLHEHRTCGKLFDPVMVCSECGEVLHAKQVHVHAGPGRRET
VG
Download sequence
Identical sequences A0A2A6N9F2 Q89S08
gi|27377715|ref|NP_769244.1| 224911.bll2604 NP_769244.1.11505 WP_011085390.1.15658 WP_011085390.1.90507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]