SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27378269|ref|NP_769798.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27378269|ref|NP_769798.1|
Domain Number 1 Region: 123-256
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.36e-23
Family GntR ligand-binding domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 54-140
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000264
Family GntR-like transcriptional regulators 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|27378269|ref|NP_769798.1|
Sequence length 266
Comment transcriptional regulator [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MWYAKNFPVNNPVKDDSHWRRFVVSLRKPTKALPNMAEADIAIVRIAPESSFKNKAYDAL
KEAILKMDIYSTPEPVMLDERALSERLGVSRTPIREAIAMLEQDGFVKTVPRRGIMVVRR
TKSEIVDMIRAWAALESMAARLITTTARKKDITALRDFFKDFGKDRLPEDHVEEYSRANI
AFHQALISLSESPVLVDLTNDLLLHVRGYRQLTIGRKDRTATSLPEHLGMIEALEARDTE
LAEKRARDHTLGLAAYVEAHGQELFT
Download sequence
Identical sequences A0A2A6N8K1 Q89QH0
224911.bll3158 NP_769798.1.11505 WP_011085942.1.15658 WP_011085942.1.2739 WP_011085942.1.3895 WP_011085942.1.53516 WP_011085942.1.53518 WP_011085942.1.67972 WP_011085942.1.69380 WP_011085942.1.90507 gi|27378269|ref|NP_769798.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]