SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27378315|ref|NP_769844.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27378315|ref|NP_769844.1|
Domain Number 1 Region: 106-235
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 6.8e-26
Family GntR ligand-binding domain-like 0.0067
Further Details:      
 
Domain Number 2 Region: 12-93
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000477
Family GntR-like transcriptional regulators 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|27378315|ref|NP_769844.1|
Sequence length 256
Comment transcriptional regulator [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MTSRIVVIPTRRAHSNHAEVARSIGVDIIAGRYAEGTRLPGDAEMIAMFGVSRPVLRESV
KTLVAKGLLTTKARVGTVVRERAAWNMFDADVLAWHLDAGIDKRFLNDLAEIRLAVEPRA
AELAAKQRSEEDVAELRRSMERMRREASDSVGFADADLALHVAVARASGNLFMRSIGHVI
EAALRASFLLSAPVEPEDRDAVLLWHQKIVDAIAAGDAEAASEAMVFVIHNGMSRHEDTV
IETAPAEVLPSADTGE
Download sequence
Identical sequences A0A0M9BDK7 A0A2A6N8V1 Q89QC4
NP_769844.1.11505 WP_011085988.1.15658 WP_011085988.1.2739 WP_011085988.1.53516 WP_011085988.1.53518 WP_011085988.1.67972 WP_011085988.1.90507 gi|27378315|ref|NP_769844.1| 224911.blr3204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]