SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27378662|ref|NP_770191.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27378662|ref|NP_770191.1|
Domain Number 1 Region: 90-225
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.73e-18
Family GntR ligand-binding domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 17-99
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000176
Family GntR-like transcriptional regulators 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|27378662|ref|NP_770191.1|
Sequence length 240
Comment transcriptional regulator [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MNDVEQKPGESGVGPVARDSLTSLVYNNLRQALMEGRFWPGHRFKIRELAATMNVSETPI
REALMQLVRGRALEMQAGRSIMVAHMTAKQYIELRTVRLFLEGLAGEHATTRISEAGIDK
MEAIHHELISAEKERRWSDAVRANWQFHRGLYDGSGLPEVLAILDDIWMRNGPLLNFHYP
HAPPIYPNEHQHLSVLNYLRQRRPDKVREAIQADMMEGGQNLVRLLEKHGGTRNMTPGED
Download sequence
Identical sequences A0A2A6N7F7 Q89PD1
NP_770191.1.11505 WP_011086333.1.15658 WP_011086333.1.90507 224911.bll3551 gi|27378662|ref|NP_770191.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]