SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27379479|ref|NP_771008.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27379479|ref|NP_771008.1|
Domain Number 1 Region: 98-233
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.39e-27
Family GntR ligand-binding domain-like 0.02
Further Details:      
 
Domain Number 2 Region: 27-96
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.91e-19
Family GntR-like transcriptional regulators 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|27379479|ref|NP_771008.1|
Sequence length 249
Comment transcriptional regulator [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MQNLRLASWNLHIWTDYCIFAFKLEPPAMLHEEVVGRIRAILLDGEIPPGARIPERELCD
RLQISRTPLREALKVLAAEGLVQLLPHRGSRAAKLTDKDMRDLFEVCQGLEALAGELACE
RISDAEIDAIAAAHTDMVRHYREGDLIQYYRGNRAIHEAIVAAAGNPALTGLYASVTARI
RRARYVTPMTPQRWAFAVKEHEAILNALQRRDGAGLSHILRAHLRHKREEVLQAGFAETE
ASDLALRIA
Download sequence
Identical sequences A0A2A6MW06 Q89M25
NP_771008.1.11505 WP_011087140.1.15658 WP_011087140.1.90507 gi|27379479|ref|NP_771008.1| 224911.bll4368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]