SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27379538|ref|NP_771067.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27379538|ref|NP_771067.1|
Domain Number 1 Region: 97-232
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 4.45e-24
Family GntR ligand-binding domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 20-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.13e-21
Family GntR-like transcriptional regulators 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|27379538|ref|NP_771067.1|
Sequence length 249
Comment transcriptional regulator [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MQERDRFLPDESRRKTEGQMKQPLKHRTLSAAIVDQLRQAILDGTYPAGSQLRQDALGDA
YGVSRIPVREALFQLEAEGLVRIVPQKGAIVSELSLDEINDVFDLRRILEPRLLAQSAPR
FTGEDFAGLDDIHKSFEKAIKARNVSEWGQLNADFHMALYVHAPQPRTRAIVLSLLQTSD
RYTRLQLSNTKAMGTAEKEHAQLIALCRAQKIDEACRFLERHIEAVRKDLLQVVAGSTIA
PKSRRKEKS
Download sequence
Identical sequences A0A2A6MVC4 Q89LW6
NP_771067.1.11505 WP_011087199.1.15658 WP_011087199.1.90507 gi|27379538|ref|NP_771067.1| 224911.blr4427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]