SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27380683|ref|NP_772212.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27380683|ref|NP_772212.1|
Domain Number 1 Region: 85-217
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.4e-26
Family GntR ligand-binding domain-like 0.017
Further Details:      
 
Domain Number 2 Region: 15-105
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.63e-16
Family GntR-like transcriptional regulators 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|27380683|ref|NP_772212.1|
Sequence length 235
Comment transcriptional regulator [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MAAKTRQKSDAPDASDRVSRIREGVTAAILEHRLLPGTKLGEDEIGEIYGASRTLVRTAL
QQLAHEGIVNIEKNRGAFVARPTPADAREVFEARRLIEPTIVDHACEAASPAWLERLGRH
LTEEREAELRGDARASVRLSGEFHKLVAEMSGHSIYLGFLKELIARSSLIILLYRRHDTP
ACGTDHHAGIVAAIRKRDKQAARAQMLSHLNEIEAELFLKDPAADETRLADVLGT
Download sequence
Identical sequences A0A0N0UF91 Q89IR2
gi|27380683|ref|NP_772212.1| 224911.bll5572 NP_772212.1.11505 WP_011088320.1.15658 WP_011088320.1.2739 WP_011088320.1.53516 WP_011088320.1.53518 WP_011088320.1.67972 WP_011088320.1.90507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]