SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27381388|ref|NP_772917.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27381388|ref|NP_772917.1|
Domain Number 1 Region: 94-234
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.01e-23
Family GntR ligand-binding domain-like 0.017
Further Details:      
 
Domain Number 2 Region: 24-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000023
Family GntR-like transcriptional regulators 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|27381388|ref|NP_772917.1|
Sequence length 257
Comment transcriptional regulator [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MILTGSRGMAGRRRMRERVKPAGETRAADVLHRMRADIISCTLKPGAKLRFEALRDIYAV
SFSTLREALSRLVAEGLVIAEDQRGFVVAPVSIDDLNDLTYVRVLIERECVALAIKNGDD
AWEADIIGAFHRMDRLQNRLGSNYYLSEEWGKLHGDFHFSLVAACGSPNLLEIRQKLFER
AHRYRRMSSQFRTKWRAKDVEHKMIMDSVVARDAAKAEELIERHIRETTDNVIKHAGHLF
VTSDEERPRRTSRVAAE
Download sequence
Identical sequences Q89GR8
NP_772917.1.11505 WP_011089017.1.15658 WP_011089017.1.90507 gi|27381388|ref|NP_772917.1| 224911.blr6277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]