SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|344204972|ref|YP_004790114.1| from Mycoplasma putrefaciens KS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344204972|ref|YP_004790114.1|
Domain Number 1 Region: 129-208
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.000000000209
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0067
Further Details:      
 
Domain Number 2 Region: 12-126
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 0.000000000249
Family Thiamin pyrophosphokinase, catalytic domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|344204972|ref|YP_004790114.1|
Sequence length 209
Comment thiamine pyrophosphokinase [Mycoplasma putrefaciens KS1]
Sequence
MKYKKALIVTAETNINLEIFNDNDNFIIGVERGCLDLIKKKIKIDLAIGDFDKVDLSELE
LIKQTAKKYEIWSSEKDYLDGELAIFKAKEVCDKNSQIIFIANATKRYDKNFSIFNLIFK
HKIKFINQDSIIFLLEKGTNILDFDKYQDITYVSFISKTNTKITIKGLKYEANDLLLEPL
STACVSNAFVAYQNATITADNAIICIMSK
Download sequence
Identical sequences M9WHT9
WP_014034966.1.288 WP_014034966.1.54435 gi|344204972|ref|YP_004790114.1| gi|482887969|ref|YP_007885139.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]