SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452206221|ref|YP_007486343.1| from Natronomonas moolapensis 8.8.11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452206221|ref|YP_007486343.1|
Domain Number 1 Region: 98-230
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 3.27e-45
Family CTP-dependent riboflavin kinase-like 0.00018
Further Details:      
 
Domain Number 2 Region: 31-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000623
Family MarR-like transcriptional regulators 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|452206221|ref|YP_007486343.1|
Sequence length 233
Comment CTP-dependent riboflavin kinase [Natronomonas moolapensis 8.8.11]
Sequence
MPRTTGRVGHDELATLKLVALDGALESRTTVTCSALADRLDASNQTASRRLQRLEDAEYL
TREVTGDGQIVSLTEAGERALQGEYADYRRLFEGDADVTLRGTVTSGMGEGRHYISLPGY
MRQFRERLGYEPFPGTLNVELGDDSARTRSRMDALDPVEIDGWADDERTYGPAFCWPATV
ETADGERYKEAHVIAPERTHHDADQLEVIAPEKLRETLAIDDGDELEVHVSEQ
Download sequence
Identical sequences M1XNQ1
WP_015408422.1.26724 gi|452206221|ref|YP_007486343.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]