SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|452206961|ref|YP_007487083.1| from Natronomonas moolapensis 8.8.11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452206961|ref|YP_007487083.1|
Domain Number 1 Region: 13-227
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.14e-43
Family Bacteriorhodopsin-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|452206961|ref|YP_007487083.1|
Sequence length 246
Comment sensory rhodopsin I [Natronomonas moolapensis 8.8.11]
Sequence
MSAIGGPGVIPLTYAIVLVGLLVGVGISIALLNSEADSREGGFLWLAAIPAIAAVSYLLM
ALDIGVVSVDGNEVYLFRYIDWLLTTPLLVGYVAYVAGAPRKWILGVAAADAGMILVGTV
ATLLTGIATWIGFGVSALFHVVLLSILYLVLPTYVEAHPRRRRLFKVLQNHVGLLWIAYP
AVWLLSPAGVGTVSTVGTAMIIAYLDVVAKTPYVYFVWRDRTAFVEDDGEFETVEDIDES
TVVGAD
Download sequence
Identical sequences M1XQE5
gi|452206961|ref|YP_007487083.1| WP_015409146.1.26724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]