SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|452206744|ref|YP_007486866.1| from Natronomonas moolapensis 8.8.11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452206744|ref|YP_007486866.1|
Domain Number 1 Region: 28-50,115-246
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0000107
Family C-terminal domain of PLC-beta 0.025
Further Details:      
 
Weak hits

Sequence:  gi|452206744|ref|YP_007486866.1|
Domain Number - Region: 55-87
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0288
Family PHD domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|452206744|ref|YP_007486866.1|
Sequence length 286
Comment conserved hypothetical protein [Natronomonas moolapensis 8.8.11]
Sequence
MADEDRGESVLLDVSEQSRQIANDLSGHQKQATELLNQHIATAGDMVGLISYNFYCPDCM
GDDIESLLEIRQEDGQWYCPTCRSSMEVPAGVPRHRIRDEIVLDIWDQLWIEKDDQKREV
YESIEDQKAELTEREFEQRREEIRTVEDRIKDIRAKIRDLQTEARAKQGIVKEMGDLMSK
YERLQQQKIERFRADVNQSFEAIDEETERVLKETEGVVEDRIEEAEKEAEARAETMREEE
RQRHRETIATQEAIAEDRAARDRVHTAAVMSTIAVTNQRKPERRGK
Download sequence
Identical sequences M1XPZ2
gi|452206744|ref|YP_007486866.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]