SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16077538|ref|NP_388352.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16077538|ref|NP_388352.1|
Domain Number 1 Region: 4-101
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.16e-23
Family Anti-sigma factor antagonist SpoIIaa 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16077538|ref|NP_388352.1|
Sequence length 109
Comment anti-sigma-B factor antagonist [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MNINVDVKQNENDIQVNIAGEIDVYSAPVLREKLVPLAEQGADLRICLKDVSYMDSTGLG
VFVGTFKMVKKQGGSLKLENLSERLIRLFDITGLKDIIDISAKSEGGVQ
Download sequence
Identical sequences A0A125UEB8 A0A165AYK2 A0A1B2B1U0 A0A1X7EMH5 A0A1Y0WP21 A0A285KCI5 D4G5E9 G4EZR9 L8AB11 M4KV87 P17903
gi|428277923|ref|YP_005559658.1| gi|16077538|ref|NP_388352.1| gi|449093170|ref|YP_007425661.1| NP_388352.1.22788 WP_003234298.1.101301 WP_003234298.1.11231 WP_003234298.1.11257 WP_003234298.1.1140 WP_003234298.1.11581 WP_003234298.1.12759 WP_003234298.1.14761 WP_003234298.1.15902 WP_003234298.1.16291 WP_003234298.1.18944 WP_003234298.1.19261 WP_003234298.1.20099 WP_003234298.1.20502 WP_003234298.1.2546 WP_003234298.1.25531 WP_003234298.1.27372 WP_003234298.1.27612 WP_003234298.1.27660 WP_003234298.1.2914 WP_003234298.1.31028 WP_003234298.1.31100 WP_003234298.1.31260 WP_003234298.1.32219 WP_003234298.1.32420 WP_003234298.1.33285 WP_003234298.1.33846 WP_003234298.1.35833 WP_003234298.1.36189 WP_003234298.1.3747 WP_003234298.1.39605 WP_003234298.1.40859 WP_003234298.1.43852 WP_003234298.1.44140 WP_003234298.1.44184 WP_003234298.1.45019 WP_003234298.1.47157 WP_003234298.1.51783 WP_003234298.1.52847 WP_003234298.1.52860 WP_003234298.1.54948 WP_003234298.1.54949 WP_003234298.1.55792 WP_003234298.1.56274 WP_003234298.1.56411 WP_003234298.1.57184 WP_003234298.1.57201 WP_003234298.1.5726 WP_003234298.1.57513 WP_003234298.1.6139 WP_003234298.1.6517 WP_003234298.1.65188 WP_003234298.1.65223 WP_003234298.1.67028 WP_003234298.1.7186 WP_003234298.1.72152 WP_003234298.1.72516 WP_003234298.1.72999 WP_003234298.1.74782 WP_003234298.1.76814 WP_003234298.1.76977 WP_003234298.1.78686 WP_003234298.1.78811 WP_003234298.1.79046 WP_003234298.1.79288 WP_003234298.1.79712 WP_003234298.1.79987 WP_003234298.1.81116 WP_003234298.1.81747 WP_003234298.1.82722 WP_003234298.1.84183 WP_003234298.1.84434 WP_003234298.1.88042 WP_003234298.1.88382 WP_003234298.1.91060 WP_003234298.1.91133 WP_003234298.1.91723 WP_003234298.1.93073 WP_003234298.1.93420 WP_003234298.1.94199 WP_003234298.1.95009 WP_003234298.1.96043 WP_003234298.1.97264 WP_003234298.1.979 WP_003234298.1.99091 WP_003234298.1.99399 gi|430756896|ref|YP_007210786.1| gi|470160627|ref|YP_007532402.1| gi|560127498|ref|YP_008828639.1| gi|402774715|ref|YP_006628659.1| gi|321314145|ref|YP_004206432.1| 224308.BSU04710 gi|472328979|ref|YP_007661255.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]