SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16078472|ref|NP_389291.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|16078472|ref|NP_389291.1|
Domain Number - Region: 31-59
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0667
Family SMI1/KNR4-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16078472|ref|NP_389291.1|
Sequence length 182
Comment hypothetical protein BSU14080 [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MKKLLKKLVVLFLSSLVIIFNVWYFIICAFSPEYYQNTNLTSNEIIRFEKLYHIDFPDET
KFIKAREYLAGPGGDTSAVLYVSLPTKRVEKVLSDYTYMKINYTDNVGSMYGVDVSKSVA
GLTTLTFGTYDKKGTFYNMKHDDDWMYKGTDWNLYFWTAASYNAVIFVFVLVIVKQMNKI
LN
Download sequence
Identical sequences A0A164SLF4 A0A1D8FJR7 L8AH88 O31696
gi|470161585|ref|YP_007533360.1| gi|16078472|ref|NP_389291.1| gi|402775650|ref|YP_006629594.1| gi|560128493|ref|YP_008829634.1| gi|430757046|ref|YP_007209890.1| NP_389291.1.22788 WP_003244760.1.11088 WP_003244760.1.11257 WP_003244760.1.1140 WP_003244760.1.11581 WP_003244760.1.12644 WP_003244760.1.12759 WP_003244760.1.1358 WP_003244760.1.15902 WP_003244760.1.16291 WP_003244760.1.19261 WP_003244760.1.23108 WP_003244760.1.27372 WP_003244760.1.27660 WP_003244760.1.2914 WP_003244760.1.32025 WP_003244760.1.32219 WP_003244760.1.32420 WP_003244760.1.32693 WP_003244760.1.33846 WP_003244760.1.36189 WP_003244760.1.39605 WP_003244760.1.40859 WP_003244760.1.44140 WP_003244760.1.44184 WP_003244760.1.45019 WP_003244760.1.47157 WP_003244760.1.56274 WP_003244760.1.56411 WP_003244760.1.57184 WP_003244760.1.57201 WP_003244760.1.5726 WP_003244760.1.57513 WP_003244760.1.6139 WP_003244760.1.64889 WP_003244760.1.6517 WP_003244760.1.65223 WP_003244760.1.69439 WP_003244760.1.71402 WP_003244760.1.7159 WP_003244760.1.7186 WP_003244760.1.72999 WP_003244760.1.76977 WP_003244760.1.78686 WP_003244760.1.79712 WP_003244760.1.81116 WP_003244760.1.81747 WP_003244760.1.82722 WP_003244760.1.88042 WP_003244760.1.89821 WP_003244760.1.90830 WP_003244760.1.91723 WP_003244760.1.92915 WP_003244760.1.93420 WP_003244760.1.94199 WP_003244760.1.95211 WP_003244760.1.96043 WP_003244760.1.979 224308.BSU14080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]