SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16078973|ref|NP_389794.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16078973|ref|NP_389794.1|
Domain Number 1 Region: 54-158
Classification Level Classification E-value
Superfamily Lysozyme-like 0.0000000276
Family G-type lysozyme 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16078973|ref|NP_389794.1|
Sequence length 225
Comment membrane protein [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MKKKRKGCFAAAGFMMIFVFVIASFLLVLLFFNRDLIKKLPIDTKTIVLERLTDYKPLVE
EELESQGLSNYTSLILGMMYQESKGKGNDPMQSSESLGLKRNEITDPQLSVKQGIKQFTL
MYKTGKEKGVDLDTIIQSYNMGAGYIDFVAEHGGTHTEELAKQYSEQQVKKNPDLYTCGG
NAKNFRYPYCYGDYTYAEKVKEKTKTVEESLQVATLETMESKAHE
Download sequence
Identical sequences A0A085C6H4 A0A125UK24 A0A1B2B4Q4 A0A1Y0WUG2 G4EV26 M4KSJ2 O34636
gi|16078973|ref|NP_389794.1| gi|402776162|ref|YP_006630106.1| gi|470162105|ref|YP_007533880.1| NP_389794.1.22788 WP_003231283.1.100042 WP_003231283.1.101301 WP_003231283.1.11088 WP_003231283.1.11257 WP_003231283.1.1140 WP_003231283.1.11581 WP_003231283.1.12644 WP_003231283.1.12759 WP_003231283.1.1358 WP_003231283.1.14761 WP_003231283.1.15902 WP_003231283.1.16291 WP_003231283.1.20502 WP_003231283.1.23108 WP_003231283.1.2546 WP_003231283.1.25531 WP_003231283.1.27612 WP_003231283.1.27660 WP_003231283.1.2914 WP_003231283.1.31028 WP_003231283.1.31260 WP_003231283.1.31786 WP_003231283.1.32025 WP_003231283.1.32219 WP_003231283.1.32420 WP_003231283.1.32693 WP_003231283.1.33846 WP_003231283.1.34621 WP_003231283.1.35833 WP_003231283.1.36189 WP_003231283.1.39562 WP_003231283.1.39605 WP_003231283.1.40859 WP_003231283.1.44184 WP_003231283.1.45019 WP_003231283.1.47157 WP_003231283.1.54948 WP_003231283.1.54949 WP_003231283.1.56274 WP_003231283.1.56411 WP_003231283.1.57156 WP_003231283.1.57184 WP_003231283.1.57201 WP_003231283.1.5726 WP_003231283.1.57513 WP_003231283.1.6139 WP_003231283.1.63795 WP_003231283.1.64889 WP_003231283.1.6517 WP_003231283.1.65223 WP_003231283.1.69439 WP_003231283.1.71402 WP_003231283.1.7159 WP_003231283.1.72152 WP_003231283.1.72999 WP_003231283.1.74782 WP_003231283.1.76814 WP_003231283.1.76977 WP_003231283.1.78686 WP_003231283.1.78811 WP_003231283.1.79046 WP_003231283.1.79288 WP_003231283.1.79712 WP_003231283.1.79987 WP_003231283.1.80832 WP_003231283.1.81116 WP_003231283.1.81747 WP_003231283.1.82722 WP_003231283.1.84183 WP_003231283.1.87300 WP_003231283.1.88042 WP_003231283.1.88382 WP_003231283.1.88591 WP_003231283.1.89821 WP_003231283.1.90830 WP_003231283.1.91060 WP_003231283.1.91133 WP_003231283.1.9164 WP_003231283.1.91723 WP_003231283.1.93420 WP_003231283.1.94199 WP_003231283.1.95009 WP_003231283.1.96043 WP_003231283.1.97264 WP_003231283.1.979 WP_003231283.1.99091 gi|560129026|ref|YP_008830167.1| 224308.BSU19130 gi|449094589|ref|YP_007427080.1| gi|384175694|ref|YP_005557079.1| APC1969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]