SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16079215|ref|NP_390039.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16079215|ref|NP_390039.1|
Domain Number 1 Region: 9-172
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.23e-25
Family SMI1/KNR4-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16079215|ref|NP_390039.1|
Sequence length 192
Comment hypothetical protein BSU21560 [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MSFTKIEQKLKEFTIDAGRYPSINTNEQLKELEMNIGNQLPSDYKDFLKKYGGCYLESKK
TTDEIEYDVCYKPLEKDPWMGKGDDTQLLEGFYGLANDHNSLQKAIDTYSDRFPRNIIPI
ASSAGGNEICMDIDNGKILFWDHELSHPDKDFFLIANSFEEFVFSLVDEPIEADKEDDGI
LYIELDDDLLSS
Download sequence
Identical sequences A0A162SC02 O31996 O64025
gi|470162357|ref|YP_007534132.1| 367784 224308.BSU21560 NP_046563.1.20604 NP_390039.1.22788 WP_004399123.1.11257 WP_004399123.1.1140 WP_004399123.1.15902 WP_004399123.1.16291 WP_004399123.1.2914 WP_004399123.1.33846 WP_004399123.1.36189 WP_004399123.1.40859 WP_004399123.1.44184 WP_004399123.1.45019 WP_004399123.1.47157 WP_004399123.1.56274 WP_004399123.1.56411 WP_004399123.1.57201 WP_004399123.1.5726 WP_004399123.1.57513 WP_004399123.1.6517 WP_004399123.1.65223 WP_004399123.1.72999 WP_004399123.1.76977 WP_004399123.1.81116 WP_004399123.1.81747 WP_004399123.1.91723 WP_004399123.1.93420 WP_004399123.1.94199 WP_004399123.1.96043 WP_004399123.1.979 gi|9630136|ref|NP_046563.1| gi|16079215|ref|NP_390039.1| O64025_BPSPB

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]