SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16079216|ref|NP_390040.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16079216|ref|NP_390040.1|
Domain Number 1 Region: 9-152
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.62e-21
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16079216|ref|NP_390040.1|
Sequence length 165
Comment hypothetical protein BSU21570 [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MSIDMLIKKIASTSDCRLFEADGLPVIDEKHQLPKDISEFYEQCGGAVLYENADYPIYIV
RPAEFELANPIIVGELCEEDISSEWYIVCTDGKGEYLTIDLNDQRKGKCYDSFFDRHGIV
GETQVIASSFTDLIQRLLENKGKHWYWLRDDYVSLGDAYDGIEIE
Download sequence
Identical sequences O31997 O64024
gi|9630135|ref|NP_046562.1| 376364 gi|16079216|ref|NP_390040.1| NP_046562.1.20604 NP_390040.1.22788 WP_003246188.1.11088 WP_003246188.1.11257 WP_003246188.1.1140 WP_003246188.1.12644 WP_003246188.1.1358 WP_003246188.1.15902 WP_003246188.1.16291 WP_003246188.1.23108 WP_003246188.1.2914 WP_003246188.1.32025 WP_003246188.1.32420 WP_003246188.1.32693 WP_003246188.1.33846 WP_003246188.1.36189 WP_003246188.1.40859 WP_003246188.1.44184 WP_003246188.1.45019 WP_003246188.1.47157 WP_003246188.1.56274 WP_003246188.1.56411 WP_003246188.1.57201 WP_003246188.1.5726 WP_003246188.1.57513 WP_003246188.1.64889 WP_003246188.1.6517 WP_003246188.1.65223 WP_003246188.1.71402 WP_003246188.1.72999 WP_003246188.1.76977 WP_003246188.1.81116 WP_003246188.1.81747 WP_003246188.1.87300 WP_003246188.1.89821 WP_003246188.1.90830 WP_003246188.1.91723 WP_003246188.1.93420 WP_003246188.1.94199 WP_003246188.1.96043 WP_003246188.1.979 O64024_BPSPB 224308.BSU21570 gi|402776414|ref|YP_006630358.1| gi|470162358|ref|YP_007534133.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]