SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16079218|ref|NP_390042.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16079218|ref|NP_390042.1|
Domain Number 1 Region: 39-175
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000196
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16079218|ref|NP_390042.1|
Sequence length 185
Comment hypothetical protein BSU21590 [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MTNFVHKTVNGLKSLLDEKGAIQLFCSEGDIMEFLVTFSPDKATLNDIQSFEAKHQLSLP
EDYQKFITLHNGAKIFEILSDGENIGGGLQLFSLEEIEEELKYEDLFEGINGIPIGYLLE
ECHLMIDKDKINQGDPNYLYIFESGLEYNPLNLNFEIFLDRYILANGEPFWDWRYYTAEN
YYRTR
Download sequence
Identical sequences A0A164XGH3 O31999 O64022
gi|16079218|ref|NP_390042.1| O64022_BPSPB gi|470162360|ref|YP_007534135.1| gi|9630133|ref|NP_046560.1| 367785 APC1441 224308.BSU21590 NP_046560.1.20604 NP_390042.1.22788 WP_003246042.1.11257 WP_003246042.1.1140 WP_003246042.1.15902 WP_003246042.1.16291 WP_003246042.1.2914 WP_003246042.1.32420 WP_003246042.1.33846 WP_003246042.1.36189 WP_003246042.1.40859 WP_003246042.1.44184 WP_003246042.1.45019 WP_003246042.1.47157 WP_003246042.1.56274 WP_003246042.1.56411 WP_003246042.1.57201 WP_003246042.1.5726 WP_003246042.1.57513 WP_003246042.1.6517 WP_003246042.1.65223 WP_003246042.1.72999 WP_003246042.1.76977 WP_003246042.1.81116 WP_003246042.1.81747 WP_003246042.1.91723 WP_003246042.1.93420 WP_003246042.1.94199 WP_003246042.1.96043 WP_003246042.1.979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]