SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16079792|ref|NP_390616.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|16079792|ref|NP_390616.1|
Domain Number - Region: 21-57
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0687
Family SMI1/KNR4-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16079792|ref|NP_390616.1|
Sequence length 93
Comment hypothetical protein BSU27380 [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MEHGEKNITIVDDQGNEQLCEVLFTFENEEFGKSYVLYYPIESKDDEEVEILASSFTPNE
DGENGELFPIETDEEWDMIEETLNTFLADEDEE
Download sequence
Identical sequences A0A063XJ14 A0A0T8Q3Y2 A0A125UKG4 A0A199WJR4 A0A1X7E922 A0A1Y0WPN2 A0A285K6R4 L8AMD5 O34828 U1ZBN9
gi|16079792|ref|NP_390616.1| gi|321312263|ref|YP_004204550.1| gi|402776890|ref|YP_006630834.1| gi|384176314|ref|YP_005557699.1| gi|470162948|ref|YP_007534723.1| gi|472331080|ref|YP_007663356.1| NP_390616.1.22788 WP_003246199.1.100042 WP_003246199.1.101301 WP_003246199.1.11088 WP_003246199.1.11231 WP_003246199.1.11257 WP_003246199.1.1140 WP_003246199.1.11581 WP_003246199.1.12644 WP_003246199.1.12759 WP_003246199.1.1358 WP_003246199.1.14761 WP_003246199.1.15902 WP_003246199.1.16291 WP_003246199.1.18944 WP_003246199.1.19261 WP_003246199.1.20099 WP_003246199.1.20502 WP_003246199.1.21045 WP_003246199.1.23108 WP_003246199.1.2546 WP_003246199.1.25531 WP_003246199.1.27372 WP_003246199.1.27612 WP_003246199.1.27660 WP_003246199.1.2914 WP_003246199.1.31028 WP_003246199.1.31100 WP_003246199.1.31260 WP_003246199.1.31786 WP_003246199.1.32025 WP_003246199.1.32219 WP_003246199.1.32420 WP_003246199.1.32693 WP_003246199.1.32861 WP_003246199.1.33285 WP_003246199.1.33846 WP_003246199.1.35833 WP_003246199.1.36189 WP_003246199.1.37074 WP_003246199.1.3747 WP_003246199.1.39562 WP_003246199.1.39605 WP_003246199.1.40859 WP_003246199.1.42762 WP_003246199.1.43852 WP_003246199.1.44140 WP_003246199.1.44184 WP_003246199.1.45019 WP_003246199.1.47157 WP_003246199.1.47672 WP_003246199.1.51783 WP_003246199.1.5262 WP_003246199.1.52847 WP_003246199.1.52860 WP_003246199.1.54596 WP_003246199.1.54948 WP_003246199.1.54949 WP_003246199.1.55792 WP_003246199.1.56274 WP_003246199.1.56411 WP_003246199.1.57156 WP_003246199.1.57184 WP_003246199.1.57201 WP_003246199.1.5726 WP_003246199.1.57513 WP_003246199.1.6139 WP_003246199.1.63795 WP_003246199.1.64889 WP_003246199.1.6517 WP_003246199.1.65188 WP_003246199.1.65223 WP_003246199.1.65841 WP_003246199.1.67028 WP_003246199.1.69439 WP_003246199.1.71402 WP_003246199.1.7159 WP_003246199.1.7186 WP_003246199.1.71916 WP_003246199.1.72152 WP_003246199.1.72516 WP_003246199.1.72999 WP_003246199.1.74782 WP_003246199.1.76814 WP_003246199.1.76977 WP_003246199.1.78686 WP_003246199.1.78811 WP_003246199.1.79046 WP_003246199.1.79288 WP_003246199.1.79712 WP_003246199.1.79987 WP_003246199.1.80832 WP_003246199.1.81116 WP_003246199.1.81747 WP_003246199.1.82722 WP_003246199.1.84183 WP_003246199.1.84434 WP_003246199.1.84556 WP_003246199.1.87300 WP_003246199.1.88042 WP_003246199.1.88382 WP_003246199.1.88591 WP_003246199.1.89000 WP_003246199.1.89821 WP_003246199.1.90830 WP_003246199.1.91060 WP_003246199.1.91133 WP_003246199.1.9164 WP_003246199.1.91723 WP_003246199.1.92915 WP_003246199.1.93073 WP_003246199.1.93420 WP_003246199.1.94199 WP_003246199.1.95009 WP_003246199.1.95211 WP_003246199.1.96043 WP_003246199.1.97264 WP_003246199.1.979 WP_003246199.1.99091 WP_003246199.1.99399 gi|560129698|ref|YP_008830839.1| 224308.BSU27380 gi|428280186|ref|YP_005561921.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]