SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16080980|ref|NP_391808.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16080980|ref|NP_391808.1|
Domain Number 1 Region: 5-145
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.14e-16
Family SMI1/KNR4-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16080980|ref|NP_391808.1|
Sequence length 147
Comment hypothetical protein BSU39290 [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MSYNFIKSNKENDFYPVNQSEIEEVEKNLNLKLPSELVNFYLEVGYGFIKGSEFNTNRIL
DPYSVRDFRLRINDFEFYPDIEIYDEFENDKLIFFEGSESALMSIELNDNNKNPIYYYDI
QIATSLTEFLRKIEENDQYYLDLLDDE
Download sequence
Identical sequences A0A125UP83 A0A164URM8 A0A1B2AZU7 L8AVL6 P40737
gi|470164150|ref|YP_007535925.1| 224308.BSU39290 NP_391808.1.22788 WP_003244256.1.101301 WP_003244256.1.11257 WP_003244256.1.1140 WP_003244256.1.12759 WP_003244256.1.15902 WP_003244256.1.16291 WP_003244256.1.18944 WP_003244256.1.19261 WP_003244256.1.20099 WP_003244256.1.25531 WP_003244256.1.27372 WP_003244256.1.27660 WP_003244256.1.2914 WP_003244256.1.32219 WP_003244256.1.33846 WP_003244256.1.34621 WP_003244256.1.36189 WP_003244256.1.39605 WP_003244256.1.40859 WP_003244256.1.44140 WP_003244256.1.44184 WP_003244256.1.45019 WP_003244256.1.47157 WP_003244256.1.52860 WP_003244256.1.56274 WP_003244256.1.56411 WP_003244256.1.57201 WP_003244256.1.5726 WP_003244256.1.57513 WP_003244256.1.6139 WP_003244256.1.6517 WP_003244256.1.65188 WP_003244256.1.65223 WP_003244256.1.72999 WP_003244256.1.76977 WP_003244256.1.78686 WP_003244256.1.81116 WP_003244256.1.81747 WP_003244256.1.82722 WP_003244256.1.88042 WP_003244256.1.91723 WP_003244256.1.93420 WP_003244256.1.94199 WP_003244256.1.96043 WP_003244256.1.979 SR497 gi|560130969|ref|YP_008832110.1| gi|16080980|ref|NP_391808.1| gi|402778093|ref|YP_006632037.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]