SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|255767411|ref|NP_389632.2| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255767411|ref|NP_389632.2|
Domain Number 1 Region: 5-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.09e-24
Family SMI1/KNR4-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|255767411|ref|NP_389632.2|
Sequence length 144
Comment hypothetical protein BSU17500 [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MEDATFHFKDPASPQEISDIEQKLGVTFPNDYKEFLLQHNGMEMFDGIEILSLEGIIEYN
EVQDFPEGYVLIGYHFDGRYVIDTNKSKNGLGYMLYLDSIDDIEDAINLDSNFEIWFDML
VSLNGTKYWEVNPNLQEYYKLVSE
Download sequence
Identical sequences A0A162SFU5 P94480
224308.BSU17500 gi|470161929|ref|YP_007533704.1| NP_389632.2.22788 WP_003245860.1.11257 WP_003245860.1.1140 WP_003245860.1.12759 WP_003245860.1.15902 WP_003245860.1.16291 WP_003245860.1.19261 WP_003245860.1.27372 WP_003245860.1.27660 WP_003245860.1.32219 WP_003245860.1.32420 WP_003245860.1.33846 WP_003245860.1.36189 WP_003245860.1.39605 WP_003245860.1.40859 WP_003245860.1.44140 WP_003245860.1.44184 WP_003245860.1.45019 WP_003245860.1.47157 WP_003245860.1.56274 WP_003245860.1.56411 WP_003245860.1.57201 WP_003245860.1.5726 WP_003245860.1.6139 WP_003245860.1.65223 WP_003245860.1.72999 WP_003245860.1.76977 WP_003245860.1.78686 WP_003245860.1.78811 WP_003245860.1.79712 WP_003245860.1.81116 WP_003245860.1.81747 WP_003245860.1.82722 WP_003245860.1.88042 WP_003245860.1.91723 WP_003245860.1.94199 WP_003245860.1.95009 WP_003245860.1.96043 WP_003245860.1.979 gi|560128847|ref|YP_008829988.1| gi|402775992|ref|YP_006629936.1| gi|255767411|ref|NP_389632.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]