SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|255767449|ref|NP_389782.2| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255767449|ref|NP_389782.2|
Domain Number 1 Region: 41-177
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.62e-16
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|255767449|ref|NP_389782.2|
Sequence length 187
Comment hypothetical protein BSU19010 [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MYVTNFVHKTVNGLKSLLDEKGAIKLFCSEGDIMEFLVTFSQDKATLNDIQSFEAKHQLT
LPQDYQKFMTLHNGAKIFEILSDGENIGGGLQLFSLEEIEEELKYEDLFEDINGIPIGYL
LEECHLMIDKDKVNQGDPNYLYIFESGLEYNPLNLNFEKFLDRYILANGEPFWDWRYYTA
ENYYRTR
Download sequence
Identical sequences L8AKJ6
gi|470162093|ref|YP_007533868.1| NP_389782.2.22788 WP_009969410.1.11257 WP_009969410.1.1140 WP_009969410.1.12759 WP_009969410.1.15902 WP_009969410.1.16291 WP_009969410.1.19261 WP_009969410.1.27372 WP_009969410.1.27660 WP_009969410.1.2914 WP_009969410.1.32219 WP_009969410.1.32420 WP_009969410.1.33846 WP_009969410.1.36189 WP_009969410.1.39605 WP_009969410.1.40859 WP_009969410.1.44140 WP_009969410.1.44184 WP_009969410.1.45019 WP_009969410.1.47157 WP_009969410.1.56274 WP_009969410.1.56411 WP_009969410.1.57184 WP_009969410.1.57201 WP_009969410.1.5726 WP_009969410.1.57513 WP_009969410.1.6517 WP_009969410.1.65223 WP_009969410.1.72999 WP_009969410.1.76977 WP_009969410.1.78686 WP_009969410.1.78811 WP_009969410.1.79712 WP_009969410.1.81116 WP_009969410.1.81747 WP_009969410.1.82722 WP_009969410.1.88042 WP_009969410.1.91723 WP_009969410.1.93420 WP_009969410.1.94199 WP_009969410.1.95009 WP_009969410.1.96043 WP_009969410.1.979 gi|255767449|ref|NP_389782.2| 224308.BSU19010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]