SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|255767599|ref|NP_390480.2| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255767599|ref|NP_390480.2|
Domain Number 1 Region: 1367-1440
Classification Level Classification E-value
Superfamily Lysozyme-like 0.000000000000985
Family Bacterial muramidase, catalytic domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|255767599|ref|NP_390480.2|
Sequence length 1585
Comment hypothetical protein BSU26030 [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MAKLTATFELHDKISRKLRMIQGNAERLKRAANGPLIFEAEDRTERVMRQIDRSANRLTA
RARLLEMGLDDRVSNGLHSIRQQAEDLTEGSHEVTVSVNDQATPRFRLIRGGLTDLNSSH
AEPTVSVRDHASNQLDEIRRHVTDVDSEHAEPTVSIKDRASAALDAIEAKIDSLKGATIT
LAVAGGFSAGSIMGSGKSTMSQDAYVSATSNVNKKDVAKMTDQIYFNNKAGSSREEVSLS
LRNLSQQTGASKKALAELTESSSKIAQLMNADQAEVDRAFSSMYNNLKLSGKQSGDLIAY
VYRNAGDQADDLLDTMNEYSSTFKDLKLTGGQIANAMIKGTKGGARNFDNLADSMREFNI
RRTEMSDSQVDAFKTLFGAKETKKMFKGFKDGSISGEESLFRVAKALSKVKDKTKRAAIA
TELIGTQYEDLKQPILDMAEGIGTSAKTSGELERSFTKLRDNNPMTPVNDAMRDFESISK
DMGTSLLTGLGPAFDKISSFINSKEGQEKLKEIKKDIADLGEEIGDKLNVAIEWSVNHWD
DLKTAIKVVIPSLIGLIGYLKILRPLLKGIGTVGSDAAGVIRKLIPKRTPKAGTNTQSER
RNRNSNRNASTRGRESKTATGPTSLPRSGSLTYCCCSDGGKNDRIRRRRGKRVLGRRGNP
NRMNPSDSSIAVSSERLERRRSGRTVGTNPTRDSRSAIITTRSELYSAGRAAGGTSKFGK
VLSPLKSVGKFAKGVPLLGTALAATDLIGMNKDNVGEKIGSAGGGLAGAATGAAIGSVIP
GVGTAIGGLVGGIAGTMGGSSLGKAFDGSEVKKKLNSTLFDQKWWSEKWSGIKSNAKTSI
NGLSDTWSNVKEKVKSTLFNSEWWSEKWSGVKSWAQNKWNSASSVWESVKGKIKSTLFSE
KWWSGKWEGVKSWAQSKWDSASSVWQSVKGKLKSTLFSEKWWSGKWESVKSWSKNKWDNA
KSIWKSVKSSISETLFSKKWWSEKWQSVKELGSSILGGVKEVGGKVASSAKKTAGKAWGY
VKSGVNYLFGSGKEKPKKHATGGYITKPTISWIGEAGKEFVIPVENNKGRGKMLLSQAAS
KLGMSVVDDIASASSAGGEPATSPLVRSAAVTASVSPIIDTSSLDEQATSFGQQFTKSFD
QGIRDNVVSMEAWKQKNVGQPMNNLISYSPNYGKQVVNGYAKGQNSTSTGTDGFLQTKVK
MPFQNTVNKSSSWGSGTIKGFASGQNSSQTGTDQYVSTHINKPFIRSKESSNGWGSGMIG
NFVSGMTSKASEVNEAAKELAKKVEKAFREELDIHSPSRVMMSLGRFASIGIVKGLDSVD
VKKFAEKQAGSLAAAYSGMGAVSGNVKQWLMAAIMATKTPMSWLPGLMTIAQHESGGNPK
AINLWDSNAKAGHPSQGLMQTIPSTFNAHKLPGMNNILNPIHNAAAAIGYIKSRYGSINN
VPGIRSMRHGGPYVGYANGGLITKEQIARVGEGNKREWIIPEERGIRGRYLLAQAAKALG
MEVTDPSEKGQTELSSGQVTAATTGRNQTTFKAAGGKEVIIQFNGDQHFHNDQDMNSLVA
KIKQALVDELEQDINIGTKGVVAFD
Download sequence
Identical sequences A0A164X372 P45931
gi|321312098|ref|YP_004204385.1| gi|560129557|ref|YP_008830698.1| gi|470162812|ref|YP_007534587.1| gi|255767599|ref|NP_390480.2| NP_390480.2.22788 WP_003246092.1.11257 WP_003246092.1.1140 WP_003246092.1.12759 WP_003246092.1.15902 WP_003246092.1.19261 WP_003246092.1.27372 WP_003246092.1.27660 WP_003246092.1.2914 WP_003246092.1.32219 WP_003246092.1.32420 WP_003246092.1.33846 WP_003246092.1.36189 WP_003246092.1.39605 WP_003246092.1.40859 WP_003246092.1.44140 WP_003246092.1.44184 WP_003246092.1.45019 WP_003246092.1.47157 WP_003246092.1.56274 WP_003246092.1.56411 WP_003246092.1.57201 WP_003246092.1.5726 WP_003246092.1.57513 WP_003246092.1.64889 WP_003246092.1.6517 WP_003246092.1.65223 WP_003246092.1.72999 WP_003246092.1.74782 WP_003246092.1.76977 WP_003246092.1.78686 WP_003246092.1.81116 WP_003246092.1.81747 WP_003246092.1.82722 WP_003246092.1.88042 WP_003246092.1.91723 WP_003246092.1.93073 WP_003246092.1.93420 WP_003246092.1.94199 WP_003246092.1.96043 WP_003246092.1.97264 WP_003246092.1.979 224308.BSU26030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]