SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29345618|ref|NP_809121.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29345618|ref|NP_809121.1|
Domain Number 1 Region: 39-112
Classification Level Classification E-value
Superfamily CalX-like 0.0000275
Family CalX-beta domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29345618|ref|NP_809121.1|
Sequence length 299
Comment hypothetical protein BT_0208 [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MKKLLLGCIAAVAALIALSGCDQDKVAYNGPSYLMFSDTLYTYAVQETNEIFNVPISATV
AADHDRTFAVEVIDRESNAVEGKHYKILSNTVTIKAGERSTNLEVQGIYDNLEINDSLGF
ALRLVIPETEQWGLYGTEAKVVMQKIRPFDIKNFTGYCVVSSTYFASYLNNLELRLVTSD
IVEGKENTIAIHGLYYDGYDTEITFNREDVQEPLVEMDEQLCASTATAFGTIYGDGKLLM
NQPTAYTSYFSTNENFVLQYVTLSVNNRDGSSYGTVGTFVNVIEWISEAEAEKLKEQGY
Download sequence
Identical sequences Q8ABA2
226186.BT_0208 NP_809121.1.73244 WP_011107167.1.59332 gi|29345618|ref|NP_809121.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]