SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29345775|ref|NP_809278.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29345775|ref|NP_809278.1|
Domain Number 1 Region: 511-756
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.05e-27
Family Vibrio cholerae sialidase, N-terminal and insertion domains 0.086
Further Details:      
 
Domain Number 2 Region: 282-507
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-26
Family Clostridium neurotoxins, the second last domain 0.042
Further Details:      
 
Domain Number 3 Region: 83-257
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000106
Family Laminin G-like module 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29345775|ref|NP_809278.1|
Sequence length 759
Comment hypothetical protein BT_0365 [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MAILTVLSMSSCQDWGEADPPAGNQKLPAKPDTSAKLIAEFTFDEDFNSTATEGKTPISG
EGFAYSADQEIPEIVQDDERESGVMHANGGYLRIPNPLIGADIQTGVSFSFFVKSTKTDH
TGALISFSDGTNKLYFTANAFLSYTGTGGYLDVNDPEVSVTNAMPYGTWHYVALTFTEKG
YAIYIDGTKKYDTNNHASISSGKTRAVSVGDFDYSNMIDLLSSATYIYLGYGSDTETAEA
YYDDLKIWTNTFSDSDAQGPNIGSGIHVPDPVYKATFETTTGLQIIGGGSFVTDDNSAFG
TVFKNIPGGMRQNYLLLPEDVMSHSAETKEMSIGMWVNAKDAGISSTYMWSPLFSAHGQA
PGIAGTANTDNWPMFALYVRGTLQLNNAGWCNFDDAQNVNGTNALYHDATDWLADHGWHY
YTVTLTATSAKVYMDGELKNEWQVAGTGDNNTIEGAFIYGANYKYITLGGNQAFDWGDPD
PGFMFDDFAVYNKELSPEQIKQIMEDKTLALPTPVYINTFEEGTGDAKIVGSGKIVSVED
KGFGQIFQNVAGSKGTNYLMLPQDALSHSVESQEVSISVWVNAKNAGASDDYRYSPLFTA
YGNEPSAGSENIWPLFVLQSRGLAQINCNGWTDFTAAQNEKGVNTVYCSEYAADGIVCEE
DWLKDHEWHLYTAVLTSTTCKIYIDGEVANSWTVSGSGDGNTISGIFTNGADLKYISLGG
NQAWTWADPDPGFMFDDIAIYNKALTIDEIQAIMKKKKN
Download sequence
Identical sequences Q8AAU9
NP_809278.1.73244 WP_011107219.1.59346 gi|29345775|ref|NP_809278.1| 226186.BT_0365 APC81306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]