SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29346459|ref|NP_809962.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29346459|ref|NP_809962.1|
Domain Number 1 Region: 190-360
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.23e-25
Family Clostridium neurotoxins, the second last domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29346459|ref|NP_809962.1|
Sequence length 393
Comment patatin-like protein [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MKQIKNIRNFLLISLIAGGTWIGCDDANYSTLDTHVFFEEALTATSTKVTVMGSGETNVT
LNAHISNTQQKDNSYSLAIDQAALDAYNKANGTNYIALPETHYTLPDNITIKAGAYNADP
ISIHIKAFSEEMNASGESYALPVRLVAKQGSIDVMPVTGSLVILANSIMEFSAPQFVGST
ELVAKKFSEAPETYNEFTVEVRFQVSNTANRNRAVFSTSGSDGKSLLLRFEDPQSDNSDH
KAHSLVQIQTHETYLNPTYSFEPNKWQHLAVTYNGSKYRIYINGKDGGSKDVAGGPCIFG
NMSWFSGGSWWSGCKILVSEARIWSVCRSEIQIQNNMTITSPKSPGLEAYWRFNEGKGNV
FEDATGKGHTITTTVTPVWIDKILSTDEATPWK
Download sequence
Identical sequences A0A174J0P3 A0A1H8GK98 D7IJF9 Q8A8W8
NP_809962.1.73244 WP_008763539.1.19130 WP_008763539.1.52087 WP_008763539.1.54521 gi|29346459|ref|NP_809962.1| 226186.BT_1049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]