SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29347039|ref|NP_810542.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|29347039|ref|NP_810542.1|
Domain Number - Region: 152-253
Classification Level Classification E-value
Superfamily CalX-like 0.00366
Family CalX-beta domain 0.021
Further Details:      
 
Domain Number - Region: 351-568
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0528
Family Glycosyl hydrolases family 16 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29347039|ref|NP_810542.1|
Sequence length 593
Comment hypothetical protein BT_1629 [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MKNILYKILPVCLLTIGLTGCEDETKYRPLPEAVPLTMSINEKAFVMGEHLKVDIKVEPD
ADGNEVVANEDFDIYFTAKAGTEDVANVFEPFSSIVTFPKGEKQIQVDFPVKTSGLVGTT
TMEFVAFARGYKMANSSQGIKVSDYYRISMSLENNTENVVTEGGKFVLVAKVDKPSSVPL
EVTITPKEGEEGRYDNLPSTLTIPAGRTSVKSAAVTIKQDYEMTGDLQLVLNLKSNSSSN
PMTAPALTITMTDLESMADPDLYDMTTVYENPNIMFVSYDDDWFTGKETAKMDEGTAHPN
AELGSQWKFDYAIEFHKNSTSGDYQKLGNATDANRGNVLKIDWIKYAKVTDEGELNICVG
VEGTNYGTAGIHCCKSLGQMWAQNVTRIYPGMRIEMKVRLGGNRTGFVPMIEVKNPATAT
TCKEAKQSICILKNVSGSAITQSVRGEVVSDAKSVVSAIPKVEDYNIYWVELVDENTIKL
GINGSTTLEVTRDMLDSWPFTKASTGTSVGAKGLYLVMRMDLFGEGNSVSSELPAGWDTE
LKSINPANYATEGPRMIIDWIRFYVNDNYKREANELVNRDYKVSIPGKFYQFY
Download sequence
Identical sequences A0A2J6A270 Q8A796
NP_810542.1.73244 WP_011107902.1.24025 WP_011107902.1.81417 gi|29347039|ref|NP_810542.1| 226186.BT_1629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]