SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29347169|ref|NP_810672.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29347169|ref|NP_810672.1|
Domain Number 1 Region: 142-451
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.7e-101
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000000976
Further Details:      
 
Domain Number 2 Region: 453-609
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-30
Family Glycosyl hydrolases family 32 C-terminal domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29347169|ref|NP_810672.1|
Sequence length 610
Comment 2,6-beta-D-fructofuranosidase [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MNVFLPVKQLQTFLICFILMTISVSTRAADSPLLIKNLGEGHCLVRVNTSQNYLLLPVED
ASPDVRISMIVNNKEVKNFDVRLAIHKVDYFVPVDLSDFSGKTVSFKFKMNSNDPIRVNL
SPDNTACCKEMKLSDTFDTTNREKFRPTYHFSPLYGWMNDPNGMVYKDGEYHLFYQYNPY
GSKWGNMNWGHAISKDLVNWEHRPVAIAPDALGTIFSGSAVVDHNNTAGFGAGAIIAIYT
QNSDRQVQSIAYSTDNGRTFTKYENNPVLVSEARDFRDPKVFWYEATKRWIMVLAVGQEM
QIFSSPNLKDWAFESSFGEGYGAHGNVWECPDLFELPVEGTNEKKWVLLCSLGDGPFGDS
ATQYFIGSFDGKKFSCDNQPNVTKWMDWGKDHYATVTWSDAPDNRRIAIAWMSNWQYAND
VPTSQYRSPNSIPRDLSLFAIDGGIYLQSAPSPELLKLRGVSKKRSFKVNGTRIVKDLIP
NNEGAYEIELSLKNQQAEIIGFRLYNDKGEEVDMQYDMKEKKFSMDRRKSGEVNFNENFP
MLTWTAIEEDKDEMKLRLFVDRSSVEAFGDGGRFAMTNQVFPSEPYNHISFYSKGGAYKV
DSFVVYKLKK
Download sequence
Identical sequences A0A0P0FCS3 C6IRF4 Q8A6W7
NP_810672.1.73244 WP_008767782.1.28290 WP_008767782.1.97929 226186.BT_1759 gi|29347169|ref|NP_810672.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]