SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29347175|ref|NP_810678.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29347175|ref|NP_810678.1|
Domain Number 1 Region: 132-447
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.26e-92
Family Glycosyl hydrolases family 32 N-terminal domain 0.000000317
Further Details:      
 
Domain Number 2 Region: 446-625
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.66e-30
Family Glycosyl hydrolases family 32 C-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|29347175|ref|NP_810678.1|
Sequence length 627
Comment 2,6-beta-D-fructofuranosidase [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MKTTPWIKLCKGAVLALTVSFGLTYCQSTKSTFTLEQKGDSLTIVHITHPTNYILLPIEE
EEADESQVRLDTGNAADTDMDIRLAQTKVDYFVPFALPADTKVATLRIQKKSKDALCWEE
IKLSDTFDTTNTDKFRPVYHHTPLYGWMNDANGLVYKDGEYHLYYQYNPYGSKWGNMHWG
HSVSKDLMHWEHLAPAIARDTLGHIFSGSSIVDQENVAGYGAGSILAYYTSASDKNGQIQ
CLAYSKDNGRTFTKYEKNPVLRPSDGLKDFRDPKVFWYAPESKWVMIVSADKEMRFYDSH
NLKDWNYLSSFGEGYGVQPCQFECPDMVELPVDGDINYKKWALIVNVNPGCYFGGSATQY
FIGDFDGTKFICDNQPNVTKWLDWGKDHYATVCFSNTGDRVVAVPWMSNWQYCNIVPTRQ
FRSANALPRELGLYTQDNDIYLSAAPVAETKNLRKESKDVPSFTVDKDYHIESLLTDNEG
AYELSLNIEAGKAEIMGFSLFNDKGEKVDIYFNLPEKKLVMDRTKSGIVDFGKNSSPHEI
EAHDRRKTTSINYIDDFALATWAPIQKENEYKLDVFVDKCSVEIFLDGGKIAMTNLIFPT
EPYNRMCFYSKGGTFAVDSFSVYRLGL
Download sequence
Identical sequences Q8A6W1
gi|29347175|ref|NP_810678.1| 226186.BT_1765 NP_810678.1.73244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]