SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29347186|ref|NP_810689.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29347186|ref|NP_810689.1|
Domain Number 1 Region: 573-898
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.68e-42
Family beta-glycanases 0.0032
Further Details:      
 
Domain Number 2 Region: 241-403,446-465
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.68e-31
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0081
Further Details:      
 
Domain Number 3 Region: 469-575
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000000000288
Family beta-Galactosidase/glucuronidase domain 0.0073
Further Details:      
 
Weak hits

Sequence:  gi|29347186|ref|NP_810689.1|
Domain Number - Region: 54-186
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000414
Family Laminin G-like module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29347186|ref|NP_810689.1|
Sequence length 1231
Comment beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MKQISKVFLACACSLSGLTTQAQDQTVWSNDFSNASQPLNMVGRGVCRVNDGVFHSRSAY
ALFGNPEWKDYTLSFKARAPKDAEQVQIWAGFRTHNRFDRYVVGIKGGLQDDLYLMRTGY
MGTDEFMGVRPLGFHPVPGEWYKVKVEVCGNRIRVFVNDEKLPHIDLEDKNSNLAPTGEV
ALGGGWIDTEFDDLTVTPLAEDALKDVKVQEYRMALTTQEKEKIRREERAQYTSVKLDKL
TADRTELSLDGNWLFMPDYQLNDKTKAISMQTNDNDWHIMPVPAFWNPIRIWLHGETMPS
PTGPQHKGVSDTYYQQETDRCENYTFNYRKTGAAWYRQWLELPADVKGKQLTLSFDAVSK
MAEVYINGESAGSNIGMFGDFQVDATRFLRPGRNLIAVKVTRDINGKAAQTSDAMENYYS
SVRKEVEDNQNDQQANKAVLTDIPHGFYGDNPAGIWQPVKLIVSNPLKVEDIFIKPALDG
ASIDVTIKNHAPKKKNFDIRVDIIDKQTGETLYGAPVRSKLSLATSAQETFTCDIKGLKP
KLWEPATPNLYDFRVSLTEGKNKVTDCITVTSGFRTFESKDGFLYLNGRKYWLRGGNHIP
FALCPNDSLLADKFMKLMKEGNVQSTRTHTTPWNELWVSAADRNGIAISFEGTWSWLMIH
STPIPDKGVLDLWSSEWLRVMKKYRNHPSIFFWTVNNEMKFYDLDADTERAKQKFRIVSD
VVKDMRKTDPTRPVCFDSNYLHNKASKRFGDDFLKTVDDGDIDDNHAYYNWYDYSVFRFF
NGEFQKQFKTPGRPLISQEMSTGYPNAETGHPTRSYQLIHQNPYSLIGYEAYDWGNPASF
LNTQSFITGELAETLRRTNEQASGIMHFAYMTWFRQCYDHRNIQPYPTYYAMQRAMQPVL
VSAELWGRNLYAGEKLHTRIYVVNDNEEGRDLKPMSLAWSIVDETNKVLASGTEQFPAVE
YYGRKYIEPNIHMPSNLPADKVNVKLKLTLTESGVTLSQNEYGLLLARKEWNIGQVTASK
KILLLDKDHMKATLDFLNIACQTVPSIKELLNAKQKANLCIISGLKECTDEEARLLREYQ
SKGGRILFLNSKEAAQKVYPEYITGWIIPTEGDIVVMERDDAPVFDGIGALELRYFNNNK
REIPLACTATLKAVRHENVKELAAQMKIHAYIDGGKPEERIARIESMRGLTLLQIADNKG
KSLVSTLCTEKATTDPIAGKLLVNMVNELLK
Download sequence
Identical sequences A0A0P0EPC4 C6IRH3 Q8A6V0
gi|29347186|ref|NP_810689.1| 226186.BT_1776 NP_810689.1.73244 WP_008767767.1.24025 WP_008767767.1.28290 WP_008767767.1.97929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]