SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29347580|ref|NP_811083.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|29347580|ref|NP_811083.1|
Domain Number - Region: 29-100
Classification Level Classification E-value
Superfamily CalX-like 0.0183
Family CalX-beta domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|29347580|ref|NP_811083.1|
Sequence length 144
Comment hypothetical protein BT_2170 [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MKKFNDANVGLFVLLTACLSLFSCNNDNDNYPKDYVGFEKSTRTVECDKNQSESELQIKI
IATDKSKEDRTVLLATPALPAGQAPIMKLTETKVTIKAGQKSATTTIKLYPKKMVLKQQN
ITLSCTPQWKEGSVSKLTILLKRN
Download sequence
Identical sequences A0A0P0FBU3 C6IRT8 Q8A5R8
NP_811083.1.73244 WP_008763954.1.24025 WP_008763954.1.28290 WP_008763954.1.29471 WP_008763954.1.52087 WP_008763954.1.59346 WP_008763954.1.97929 gi|29347580|ref|NP_811083.1| 226186.BT_2170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]