SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29347592|ref|NP_811095.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29347592|ref|NP_811095.1|
Domain Number 1 Region: 21-197
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-26
Family Beta-D-xylosidase C-terminal domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29347592|ref|NP_811095.1|
Sequence length 213
Comment hypothetical protein BT_2182 [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MSIALLAAATSSMAQSLDKMNWLNEPQQWEIKEGKALVMDVPAKTDFWRISHYGFTVDDG
PFYYATYGGEFEVKVKITGNYVTTFDQMGLMLRIDHENWIKAGVEYVDGKQNVSAVVTHR
TSDWSVVQLPDAPRSLWIKAVRRLDAVEIFFSRDDKEYTMIRTCWLQDNCPVMVGLMGAC
PDGKGFTATFEEFKVTPLADQRRLEWAKKQADK
Download sequence
Identical sequences A0A2J6AEI5 D7I7X3 Q8A5Q6
NP_811095.1.73244 WP_008759723.1.24025 WP_008759723.1.28290 BtR35 gi|29347592|ref|NP_811095.1| 226186.BT_2182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]