SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29347613|ref|NP_811116.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29347613|ref|NP_811116.1|
Domain Number 1 Region: 52-258
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.28e-27
Family Clostridium neurotoxins, the second last domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29347613|ref|NP_811116.1|
Sequence length 317
Comment hypothetical protein BT_2203 [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MYTHLTDMTNMLDTAKIGTSDGTFPLANAQNLQKAVEELQTGISKGMAGYFVLQYEIDNY
CIAAEKAIAEFQDSYQQTLQPGTPAELKVFGIDGKGRIEFGSDPAYGGGNTFTVESWVKY
DAGFFESGIGSFLSTFDGKQPNEGWMINFLGSNLRTTIGMGPQEGRVLEEGRAYPDNFGK
WNHVVTVWDNTLPEGQLKMYVNGELFFSKTNDVKNDAGVLQNYMPNTRNQNMWAFQEPTD
NSRCMTGFIKKFRMWSTAKSANEVKTLMNSDVTGTESGLVCAWDFTTVVEDVTNIPDKTG
KHVAKIVGNYKWFKVEN
Download sequence
Identical sequences A0A139KVY9 Q8A5N5
APC81706 NP_811116.1.73244 WP_011108169.1.29471 WP_011108169.1.59346 WP_011108169.1.81417 WP_011108169.1.83447 gi|29347613|ref|NP_811116.1| 226186.BT_2203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]