SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29348261|ref|NP_811764.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29348261|ref|NP_811764.1|
Domain Number 1 Region: 35-301
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.57e-73
Family alpha-L-arabinanase-like 0.0000298
Further Details:      
 
Domain Number 2 Region: 331-511
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-42
Family Beta-D-xylosidase C-terminal domain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29348261|ref|NP_811764.1|
Sequence length 514
Comment beta-xylosidase [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MNTKILCVWIALLTCQIAGAQTKNVTWGDQGNGTYINPILNADYSDPDVIRVGDKYYMVN
SDFHYMGMPVLESDDMINWKIISQVYRRLDFPDWDTNGNYGGGSWAPSIRHHDGKFWIYF
CTPREGLMMSTATDPHGPWSPLHCVKRIGGWEDPCPIWDDNGQAYLGRSQLGAGPIILHK
MSADGRTLEDDGHVIYTGPVAEGTKFHKRDGYYYISIPEGGVGEGWQTILRSKNIYGPYE
KKVVLEKGSTNVNGPHQGALVDTPEGEWWFYHFQLTEPLGRVVHLQPAHWKDGWPVIGVD
IDMNGIGEPVKVWTKPNTGKKVPVSFPQGGDSFDSPELNLQWQFNHNPSDADWNLTERKG
WLLLKALKADHLRASRNMLTQKCIGYEGTVTTEMDMSSWTEGQRAGLFCIGNLFNGIGIL
KENGKNYLYLENNGSVEKVKPVSGKKIYFRATMNARTNQHQLYYSTDNKNFTPCGEAYSL
RFGDWKGARVGLYSYNTLRDGGNAFFNWFTYDFN
Download sequence
Identical sequences Q8A3V2
226186.BT_2852 gi|29348261|ref|NP_811764.1| NP_811764.1.73244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]