SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29348321|ref|NP_811824.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29348321|ref|NP_811824.1|
Domain Number 1 Region: 27-341
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.07e-50
Family alpha-L-arabinanase-like 0.0046
Further Details:      
 
Domain Number 2 Region: 1345-1467
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.33e-18
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.024
Further Details:      
 
Domain Number 3 Region: 1135-1293
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-16
Family Clostridium neurotoxins, the second last domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29348321|ref|NP_811824.1|
Sequence length 1544
Comment glycosylhydrolase [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MIQRLSFWIIMIICSTMVYGQEHDGDYTNPILSSGADPWVIKHEGWYYYCSGVPGGIGVS
RSRDLHKINPPVRVWKVPEKGQWNSTCVWAPELHFWKGKWYIYYAAGYSGPPFIHQKAGV
LESVTSDAMGKYVDKGMLFTGDALGDWENNRWAIDMTLLDHKGQLYAVWSGWEGNELTDK
TQQHLYIAKMLNPWTMASGRVKISSPDRYYEQGELPLNEGPQILKHEKDVFIVYSCGQSW
LDTYKLSYLRLKDSDADLLDPESWIKSEKPAFEGTNQVLGVGHASFTTSPDDREYYICYH
SKREKTPGWKRDIRLQKFTFDASGVPCFGKPVSVGEKLPLPSGTTHLVKAKSMVDLEKDF
TELSSTARPYTYWFWMNGNITKEGITKDLEAMHRIGVGGVFNLEGGTGIPKGAVTYLSSE
WSELKAHAVKEAARLGIDYVMHNCPGWSSSGGPWITPEYSMQKLTWSEIEVVGGEQIDTL
LPQPAMELGYYKDVAILAFPSFRNGKPIGFSDWQLLNNSVFNHKGLIDIREYDKEQVIHP
EDVIDLTKQVDSNGCLSWEAPSGNWTIIRMGHTSTGRKNCAAPDTGVGLECDKFSKQAIQ
LHFNKMMDLLYPLIKPYVHQIQIGLEIDSWEVGMQNWTSGFEDEFCERTGYDLIRYLPAM
TGKIVGSKEITERFLWDIRRIQADLLADNYYGEFRSLCNQYGLVSYCEPYDRGPMEELQI
GSRVDGVMGEFWNGLSAIFQNNLMMRRTAKLASSIAHINGQKVVGAEAYTSEPESGRWQE
YPFALKAVGDKAFTEGINRMVVHRYAMQPHSNAVPAMTLGPWGIHFDRTNTWWEPARAWM
DYLNRCQTLLQEGLFVADLAYFTGDNVVGYTKVHRNELNPVPPEGYDYDLMNTETLLNRA
WIEQGRLRLPDGMSYRILVLQEQSYITLGLLRKLREMVEQGLVIVGARPHQTVGLQSYSI
TEEKEFEQLCDELWGKNMATMIDRNIGKGRVFWEISLNLNQVFRQIQLKPDFEVGDNPNS
APIRYIHRQIGDTDVYFVTNQRRTPEDIICNFRVEGKVPEFWNPLTGERSRALVYQKNEG
MTSVPIQLDEYGSVFVVFRSDLPEQTAIRSIYKDSECLVDASVVSVEEQEQAKYFGVKDD
FSISLWVKPESDAMLNTDNPMGYISYPWTEYYAIYPSHGELLYGTGHATCGMAIGRNGVA
VWENAKGYPEFKMAVEKPISGWSHICLVYKEGAPHIYINGEYVTYKTRSLQTIHPGLNPT
TLKEGASYYNGDMSVPVLFQRVLSNKEISRLAAEGYVKKADERALNWVPYADNRFLLAWH
DGNYDFITSDGVKKKIKVEKVGTPVMLNQKWEITFPDGCGAPEKITLPKLFSLHKHEDEG
VKYFSGTATYMTDFVIKASILSDEKVVFLDLGAVEVMAEVIVNGVNKGILWARPYSIDVT
DVLKPGKNTLEIKVTNQWTNRLIGDEQLPEENEYVLGGGINGIAALSRGAIKKLPDWYKN
GVNKPKGGRVAFTTWKHYRKDSPLLESGLIGPVRLVFAKKIELK
Download sequence
Identical sequences A0A1H5TGP2 C6IIZ8 Q8A3P2
gi|29348321|ref|NP_811824.1| NP_811824.1.73244 WP_008767197.1.28290 226186.BT_2912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]