SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29348931|ref|NP_812434.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29348931|ref|NP_812434.1|
Domain Number 1 Region: 136-339
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.94e-24
Family Clostridium neurotoxins, the second last domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29348931|ref|NP_812434.1|
Sequence length 390
Comment hypothetical protein BT_3522 [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MKRIMNTKYSIKKVWYYLLCMIMTLQLIACTEETHESYTAAPEVEDIYIDQLEELINKMK
DLQKNSEYGEKKGQYPTESRAILTDAIDDANRSVLLIKYQNPVPSEQEKQRYVASAKSAI
DKFKGTIRTEDAETTPAELFVDGKGGNSYIDFGRSEEYVKFGEQGHQSFTVELWVKVTER
GRWDNCLFLCSYMSDSSWRNGWMMYWRKDDNGVYRTTWGGLNTTNGDRDLWEPKFQISDD
LNKWQHFVAVYSDEGLDGNSTLRAKLYLNGELKKEETVSPTTRVYQSGHYSDYSKPMTAF
GRYMRVSDDLYEEGFSGYMKKIRIWKTAKGADYVKQSYEGTAEVTGKETDLAAGWDFTSK
PSGTDNEIIDLTGRHTAKIIGTYKWERILE
Download sequence
Identical sequences A0A139KE02 Q8A1Y6
NP_812434.1.73244 WP_011108859.1.19130 WP_011108859.1.24025 WP_011108859.1.28290 WP_011108859.1.29471 WP_011108859.1.59332 WP_011108859.1.59346 WP_011108859.1.81417 WP_011108859.1.83447 WP_011108859.1.97929 226186.BT_3522 gi|29348931|ref|NP_812434.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]