SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29349064|ref|NP_812567.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29349064|ref|NP_812567.1|
Domain Number 1 Region: 26-290
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 3.38e-66
Family alpha-L-arabinanase-like 0.0000116
Further Details:      
 
Domain Number 2 Region: 539-797
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 3.14e-29
Family alpha-L-arabinanase-like 0.0087
Further Details:      
 
Domain Number 3 Region: 308-485
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-16
Family Beta-D-xylosidase C-terminal domain-like 0.021
Further Details:      
 
Domain Number 4 Region: 496-559
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 0.0000012
Family Glycosyl hydrolases family 32 N-terminal domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|29349064|ref|NP_812567.1|
Sequence length 811
Comment beta-xylosidase [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MKKLLLFILLVCATVQAYSQEYPKVVLSGDYPDPSVMRDGEDYYMTHSPFYYAPGFLIWH
SRDLMNWEPVCRVMPEYEGSAMAPDLLKYKGKYYIYYPAKGTNWVIWANDIKGPWSKPID
LKVSGIDPGHIADQEGNRYLYVDKGEVIRLTDDGLATIGQKQKVYEGWRYPNHWETECMC
LESPKLNYHNGYYYLTSAQGGTAGPATSHMAVAARSKSVTGPWENSPYNPVVHTYSAHDN
WWSKGHGTLIDDVNGNWWIVYHAYAKGYHTLGRSTLIEPIEWTADGWYRTKSTATPIKTD
PSIKHGLSLSDDFEGPEPGLQWTFWKEYAPQSLSFKKQTLWIDAKGSTPSDARLLLATAE
DKNYETQVEVNVGKGNTAGLLLYYSEKAYAGVVSDGKNFTIYRNAENSFTLPNKLGKRFL
AKIQNQGNSVRIAVSKDGKEWTTLVENMDVSQLHHNNYGGFYALRIGLLSSGKGSAGFRQ
FRYRNAIPQEKDMGAYLMVFHKDETHSLYMAVSDDGYTFTALNDGKPVIAGDTIALQKGI
RDPHIFRGPDGAFYLSMTDLHIYAQKDGFRDTEWERDGKEYGWGNNRGLVLMKSWDLINW
KRTNARFDLLSAGLGEIGCVWAPEVTYDDKKGKLMIYFTMRFKNEANKLYYVYVNDDFDR
IETLPQILFEYPNEKISAIDGDITKVGDRYRMFYVSHDGGAGIKQAVSDRINGDYEYDPR
WYDFEPRACEAPNLWKRIGEDKWVLMYDVYGINPHNFAFIETSDFVNFKNLGRFNEGVMK
TTNFSSPKHGAVIHLTKEEAAKLRSHWENRK
Download sequence
Identical sequences A0A1H5YNA1 C6IPR9 Q8A1K5
NP_812567.1.73244 WP_008767047.1.28290 226186.BT_3656 gi|29349064|ref|NP_812567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]