SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29349071|ref|NP_812574.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29349071|ref|NP_812574.1|
Domain Number 1 Region: 2-245
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 4.71e-51
Family alpha-L-arabinanase-like 0.0013
Further Details:      
 
Domain Number 2 Region: 265-451
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-36
Family Beta-D-xylosidase C-terminal domain-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29349071|ref|NP_812574.1|
Sequence length 453
Comment beta-xylosidase [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MVIIHSKDLVNWTIKGHVVSDLRQISEEMNWTRMNRYGRGIWAGAIRYYQGKFYVYFGTP
DEGYFMSTATDPAGPWEPLHCVKAEKGWDDCCPFFDDDGQLYFVGTHFADKYKTYLYRMT
PDGKTLIENSKILINEGYGREASKLYKINGTYYHFFSEVKNGGRYIMMQRSSSITGPYLE
RKQLSHVQREYNEPNQGGLVEGPDRKWYFFTHHGTGDWAGRIASLLPVYWVDGWPIIGEV
GQDGIGTMVWQAAKPSNEYPVRTPQSSDDFSKSVLSPQWEWNYQPRDEMWSLTERPGNLR
LKAFRPLVTDNLLKAGNTLTQRCFRTNKNEVIVKMNIEGMVDGQKAGLCHYSKSYAMVGV
RQSGKDRNLEFQTNKEKITGPAIKGNKVWIKSVWGLDGKSQFSYSTDGRKFTPFGEVYQL
EWGYYRGSRIGIYCFNNIADAGYIDVDEFIYLY
Download sequence
Identical sequences A0A1H5YQN1 I0PZC7 Q8A1J8
NP_812574.1.73244 388415 APC82022 gi|29349071|ref|NP_812574.1| 226186.BT_3663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]