SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29349199|ref|NP_812702.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29349199|ref|NP_812702.1|
Domain Number 1 Region: 322-504
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000111
Family Trypanosoma sialidase, C-terminal domain 0.052
Further Details:      
 
Weak hits

Sequence:  gi|29349199|ref|NP_812702.1|
Domain Number - Region: 58-102,136-156,200-235
Classification Level Classification E-value
Superfamily NHL repeat 0.0243
Family NHL repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|29349199|ref|NP_812702.1|
Sequence length 545
Comment hypothetical protein BT_3791 [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MKIVKYIVIVSLFSISACSDDDDKKNNERPGNLVELQVDVNEINIAQGDTRTVNITSGNG
EYVATSANEEVVVAEIDGNVVKLTAVEGHNNAQGVVYVSDKYFQRTKILVNTAAEFELKL
NKTLFTLYSQVEGSDEALIKIYTGNGGYSLEVIDDKNCIEVDQSTLEDTESFMVKGIAQG
NAEIKITDQKGKEAFVNLNVIAPKQITTDADEKGVLINSNQGSQQVKILTGNGEYKVLDA
GDAKIIRLEVYGNVVTVTGRKAGETSFTLTDAKGQVSQTIHVKIAPEKRWYMNLGKEYAV
WTHFAEMTGEGLEAVKVETNGFKLKKMTWELVARIDGTNWLQTFMGKEGYFILRGGDWEN
NKGRQMELVGIDDKLKLRTGHGAFELGKWSHIALVVDCSKGKDDYNEKYKLYVNGKQVKW
DDSRKTDMDYSEIDLCAGNDGGRVSIGRASDNRCFLDGAILEARIWTVCRTEEQLKANAW
ELHEQNPEGLLGRWDFSAGAPTSYIEDGTNSDHELLMHISKYDSWNATEFPMSRFGEAPI
EVPFK
Download sequence
Identical sequences Q8A175
gi|29349199|ref|NP_812702.1| NP_812702.1.73244 226186.BT_3791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]