SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29349269|ref|NP_812772.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29349269|ref|NP_812772.1|
Domain Number 1 Region: 89-320
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.11e-22
Family Clostridium neurotoxins, the second last domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|29349269|ref|NP_812772.1|
Sequence length 380
Comment hypothetical protein BT_3861 [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MKNNYLYNWVVIVFMMLQMLAFTSCSDDDDNSGWPTETDKTEIFIERFSTLVTNLTALRD
GATYGELKDNYPVSSKAMLDDEIVYLEETIAKLKEGNKKLADSEADRIIREANQIEKNFR
ATRRTEDFLPVAAELLVNGKNGGYIDFGVHPEYSAFGEQGQQAFTVEFWVKLTDVDEYLN
SFVFLLSTFTDDDTKDHERKGWAVNSHFGRLRMTYGIGYSDLFEPGFSFSTLNQWVHVAV
VTNENGVDGEVRDGIPVMTKIYVNGQLMLSERGRDDRLPYTPNDKEVAMVAFTGLSATAN
RIGEKSTNGCMRHLHIWKSAKTQAEIQHLMDTPESVTGSESDLVCGWTLNKTVSDNNNIK
DLTGKFSARLIGDFQWVENR
Download sequence
Identical sequences A0A173TPI9 C6IM38 Q8A110 R9H116
NP_812772.1.73244 WP_008764133.1.24025 WP_008764133.1.28290 WP_008764133.1.29471 WP_008764133.1.67099 WP_008764133.1.81417 WP_008764133.1.83447 gi|29349269|ref|NP_812772.1| 226186.BT_3861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]