SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29349394|ref|NP_812897.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29349394|ref|NP_812897.1|
Domain Number 1 Region: 181-362
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.43e-26
Family Pentraxin (pentaxin) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29349394|ref|NP_812897.1|
Sequence length 384
Comment patatin-like protein [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MKLYKYCFALLALTTVTVSGCKNEDINEEHHYDNKLYVSSAPVCDDLLIKPSITEATREL
SYRIASPAEQDIQISFDAAPAMTAAYNLIYNDNATALDSYFYNMPTKTATIKAGDISSDN
IVIDFKNTNELDKSKRYVLPVTILDASNIDVLESARTAYFIFKGAALINVVANIKEIYFP
INWKSSVNSLSTVTIEALVRSEDWVAGRDNALSSVFGIEGKFLVRIGDADRPRDQVQVVA
PGGNFPGPNVVPGLPVNEWVHIAIVYDNTTKERIYYKDGVPVYKDEAASGNVSLSSGCYI
GRAWDDTRWLPGDISEVRVWSVQRTAEQIATNPYEVDPASEGLVAYWKFNEGAGNVITDQ
TGHGNDITGSGDPTWVKVEIPKIN
Download sequence
Identical sequences D7IBC6 Q8A0N5
226186.BT_3986 gi|29349394|ref|NP_812897.1| NP_812897.1.73244 WP_008760901.1.29471 WP_008760901.1.59332 WP_008760901.1.81417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]