SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29349503|ref|NP_813006.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29349503|ref|NP_813006.1|
Domain Number 1 Region: 25-321
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.09e-79
Family alpha-L-arabinanase-like 0.00019
Further Details:      
 
Domain Number 2 Region: 329-509
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-19
Family Beta-D-xylosidase C-terminal domain-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|29349503|ref|NP_813006.1|
Sequence length 512
Comment beta-xylosidase [Bacteroides thetaiotaomicron VPI-5482]
Sequence
MKKIGLFLFDICFALQMVAQEQNYFTNPVIRGDVPDPSVIRIEDTYYATGTSSEWAPFYP
MFTSKDLVNWKQVGHVFTKQPSWTSNSFWAPELFYHNNKVYCYYTARQKSTGISYIGVAT
SDSPLHEFTDHGPIVEYGKEAIDAFIYDDNGQLYISWKAYGLDTRPIELLGCKLSADGLH
LDGEPFTLLVDEKGIGMEGQYHFKEGDYYYIVYAAHGCCGPSSDYDVYVARARNYGGPYE
KYSGNPILHGGEGDYKSCGHGTVVRTSDGRMFYMCHAYLKGDGFFIGRQPILQEMEMTDD
HWVRFKTGNLAIAEQPIPFVGTKQEPLSDFEDNFKGNQLKVDWTWNYPYSDIHAVLKKGK
LFLSGTPKNNNKYGTALCLRPQSPQYSCETKVINTGKGLKGLTLYGDDKNLIAWGIEGDK
LILKVVKDDIESVLYDSAFASKEIYLKLEVEQGCIFHFYKSLDGKTWQSVQNTPFKGKSL
IRWDRVQRPGLLHYGDKDVPAEFSYFKMKNLK
Download sequence
Identical sequences A0A0P0F983 Q8A0C6
226186.BT_4095 gi|29349503|ref|NP_813006.1| NP_813006.1.73244 WP_011109097.1.24025 WP_011109097.1.59346 WP_011109097.1.83447 WP_011109097.1.97929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]