SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000037 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000037
Domain Number 1 Region: 25-223
Classification Level Classification E-value
Superfamily HAD-like 1.49e-24
Family Phosphoserine phosphatase 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000037   Gene: ENSBTAG00000000033   Transcript: ENSBTAT00000000037
Sequence length 267
Comment pep:known_by_projection chromosome:UMD3.1:19:37978510:37985160:1 gene:ENSBTAG00000000033 transcript:ENSBTAT00000000037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGCFPVAGLRCLSRDGGMAAQGSPRFLLTFDFDETIVDENSDDSIVRAAPGQRLPESLR
ATYREGFYNEYMQRVFQYLGDQGVRPRDLRAVYESIPLSPGMGELLQFVAKQGSCFEVIL
ISDANTFGVESALRAAGHQGLFRRIFSNPSGPDARGLLALRPFHSHSCARCPANMCKHKV
LSDYLRERAHDGVHFERLFYVGDGANDFCPVGLLAGGDVAFPRRGYPMHRLIQEAQKAEP
SSFRASVVPWENAIEVRLHLQQVLKTC
Download sequence
Identical sequences E1BCN8
9913.ENSBTAP00000000037 ENSBTAP00000000037 NP_001180048.1.59421 NP_001180048.1.76553 XP_010841060.1.44457 XP_015314264.1.76553 XP_015314265.1.76553 XP_019837358.1.53367 ENSBTAP00000000037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]