SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000106 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000106
Domain Number 1 Region: 426-492
Classification Level Classification E-value
Superfamily EF-hand 0.0000074
Family Calbindin D9K 0.073
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000000106
Domain Number - Region: 96-230
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00759
Family HBL-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000106   Gene: ENSBTAG00000000097   Transcript: ENSBTAT00000000106
Sequence length 494
Comment pep:known_by_projection chromosome:UMD3.1:3:100020902:100054984:1 gene:ENSBTAG00000000097 transcript:ENSBTAT00000000106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKRKELNALIGLAGDSRRKKPKKGSGHRLLRTEPPDSDSESSSEEEEEFGVAGNRSRFV
KGDYLRCCRICYPLCAFVILAACVVACVGLVWMQVALKEDLDSLKEKFRTMESNQKSSFQ
EIPKLNEELLSKQKQLEKIESGQLGLNNVWINITEMNKQISLLTSAVNHLKANVKSAADL
ISLPATVEGLQKSVASIGNTLNSVHLAVEAIQKTVDEHKKTVELLQSDMNQHTLKESNGS
NQIIPSPSTISELDNKTHSENLKQDILYLHSFLEEVNSARVGYQRQNDLKLEGMNETISN
LTERVNLIERDLVAMSKVEKQANLSSSMVNDRAATLKRESLHQVTNRIKSVKSQGIKKED
SSDSQVSKLREKLQLISALTNKPESSRPPKTASEEQVQNFTSQPSTLPKFPQSLGDQIEK
AVQLRPVSLPGISSIEDLQGLFHKTGQDVDGKLTYQQIEDTLESVGPEPERLREFDSDGD
GRYSFLELRAALGV
Download sequence
Identical sequences E1BKH6
XP_002686458.1.76553 XP_589637.3.59421 9913.ENSBTAP00000000106 ENSBTAP00000000106 ENSBTAP00000000106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]